PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07059.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 414aa    MW: 46397.8 Da    PI: 5.3696
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07059.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.21.9e-5071311128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lp+GfrFhPtdeelv++yL +k++++++++  vi+e+d+yk++Pw+Lp++   +ekewyfFs+rd+ky++g+r+nra+ +gyWkat
  Rsa1.0_07059.1_g00001.1   7 LPAGFRFHPTDEELVKFYLIRKCSSEQISA-PVIAEIDLYKFNPWELPEMSLYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKAT 91 
                              799*************************99.89***************66566899****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++ +   ++ g+kk Lvfy g+apkg kt+W+mheyrl
  Rsa1.0_07059.1_g00001.1  92 GADKPIGK--PKTLGIKKALVFYAGKAPKGIKTNWIMHEYRL 131
                              ******98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-593159IPR003441NAC domain
PROSITE profilePS5100558.9197159IPR003441NAC domain
PfamPF023652.0E-268131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MKAELNLPAG FRFHPTDEEL VKFYLIRKCS SEQISAPVIA EIDLYKFNPW ELPEMSLYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGI  120
KTNWIMHEYR LANVDRSASV NKKNNLRLDD WVLCRIYNKK GTMEKYYPAD EKPRIMTTTA  180
SSPFDTSVSS TLQEEDCSSS GGHVVSPDAK EEVQSEPKWR ELEDALEAFD SSMFGGGGGG  240
SMDLLQSDAF VPQFMYQPTD CFTSFFQDPL EQKPFLNWSF APQGTNFAFV NGIEVTSIPA  300
DIYTSIIDGT LTIDNGTALE NDYIFAASLA ISETADPNMT IQCTPSYVVA PVRVYPTARY  360
MVQRLKKGML DQIVDPYLKG EITPKCFKKF AETAMKCVLD QGIERPSMGV FCGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-81216510174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2458820.0AY245882.1 Brassica napus NAC-domain protein 5-7 (NAC5-7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013726917.10.0PREDICTED: protein ATAF2-like
SwissprotQ9C5981e-178NAC81_ARATH; Protein ATAF2
TrEMBLM4CP770.0M4CP77_BRARP; Uncharacterized protein
STRINGBra006015.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-179NAC family protein